PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Sopen02g029860.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; asterids; lamiids; Solanales; Solanaceae; Solanoideae; Solaneae; Solanum; Lycopersicon
Family ZF-HD
Protein Properties Length: 296aa    MW: 33532.2 Da    PI: 8.1131
Description ZF-HD family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Sopen02g029860.1genomespennView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1ZF-HD_dimer104.38e-3393148460
       ZF-HD_dimer   4 vrYkeClkNhAaslGghavDGCgEfmpsegeegtaaalkCaACgCHRnFHRreveee 60 
                       vrYkeClkNhAa+lGg+++DGCgEfmps gee t++ lkCaAC+CHRnFHR+e+e+e
  Sopen02g029860.1  93 VRYKECLKNHAANLGGYVLDGCGEFMPS-GEEETPEYLKCAACDCHRNFHRKETEDE 148
                       89*************************9.8888********************9876 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PfamPF047701.1E-3093145IPR006456ZF-HD homeobox protein, Cys/His-rich dimerisation domain
ProDomPD1257742.0E-2093146IPR006456ZF-HD homeobox protein, Cys/His-rich dimerisation domain
TIGRFAMsTIGR015669.5E-3094144IPR006456ZF-HD homeobox protein, Cys/His-rich dimerisation domain
PROSITE profilePS5152325.90795144IPR006456ZF-HD homeobox protein, Cys/His-rich dimerisation domain
Gene3DG3DSA:1.10.10.602.3E-29227294IPR009057Homeodomain-like
SuperFamilySSF466891.32E-18228293IPR009057Homeodomain-like
TIGRFAMsTIGR015653.3E-26232289IPR006455Homeodomain, ZF-HD class
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 296 aa     Download sequence    Send to blast
MEHRGQEKDM GLSNPNPMSY NPSQLNQQES SSSAANKFLT APIAPNRTTN EHENTIFSPN  60
QTLDQHNITQ SSDPDPVRQL STSSASERNI TPVRYKECLK NHAANLGGYV LDGCGEFMPS  120
GEEETPEYLK CAACDCHRNF HRKETEDESQ TPGVHRNNHR IPNQTPPSLP AVPTQQQHHH  180
KYSHSYPRGH MAPVMMSFGG NTGVAAESSS EDLNMFHGGQ GIIQPCNFSA SKKRFRTKFS  240
QQQKDRMLEF AEKLGWRIQK QDEQEVHQFC NEVGVKRQVF KVWMHNSKQA TKKKQT
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
1wh7_A1e-222332881873ZF-HD homeobox family protein
Search in ModeBase
Binding Motif ? help Back to Top
Motif ID Method Source Motif file
MP00268DAPTransfer from AT2G18350Download
Motif logo
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieveRetrieve
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankHG9754410.0HG975441.1 Solanum pennellii chromosome ch02, complete genome.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_015064086.10.0PREDICTED: zinc-finger homeodomain protein 6
TrEMBLK4BB300.0K4BB30_SOLLC; Uncharacterized protein
STRINGSolyc02g085160.1.10.0(Solanum lycopersicum)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
AsteridsOGEA51824128
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT2G18350.12e-68homeobox protein 24